Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM0682 (PM0682)

This Recombinant Pasteurella multocida Uncharacterized protein PM0682 (PM0682) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Uncharacterized protein PM0682

UniProt

Q9CMX0

Expression Region

1-102

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGYRQAVRHRVLISAFLGSNPSTPAILSNNLHPLHIKIFQLGYRQAVRHRVLISAFLGS NPSTPAITFLNFDFTYFVLRLFYFYFKIFIIFSNLFYRYFPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERBB1 / EGFR / HER1, Fc Tag
E24PHA108 50 µg

Human ERBB1 / EGFR / HER1, Fc Tag

Sign In for Pricing
View Details
Pi16-set siRNA/shRNA/RNAi Lentivector (Rat)
36623096 4x 500 ng

Pi16-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Phospho-Estrogen Receptor beta (Ser87) Polyclonal Antibody, APC Conjugated
bs-6959R-APC 100 µL

Phospho-Estrogen Receptor beta (Ser87) Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant human CD19 protein
ATGP3816-250 250 µg

Recombinant human CD19 protein

Sign In for Pricing
View Details
Rat Esophagus Paraffin Sections
RP-301 10 Slides

Rat Esophagus Paraffin Sections

Sign In for Pricing
View Details
PRRX2, CT (PRRX2, PMX2, PRX2, Paired mesoderm homeobox protein 2, Paired-related homeobox protein 2) (FITC)
MBS6337878-01 0.2 mL

PRRX2, CT (PRRX2, PMX2, PRX2, Paired mesoderm homeobox protein 2, Paired-related homeobox protein 2) (FITC)

Sign In for Pricing
View Details