Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C6orf50 (C6orf50)

This Recombinant Human Putative uncharacterized protein C6orf50 (C6orf50) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C6orf50, Nasopharyngeal carcinoma-associated gene 19 protein

UniProt

Q9HD87

Expression Region

1-102

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANTQLDHLHYTTEFTRNDLLIICKKFNLMLMDEDIISLLAIFIKMCLWLWKQFLKRGSK CSETSELLEKVKLQLAFTAYKYVDICFPEQMAYSRYIRWYIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSHZ1 Mouse Monoclonal Antibody [Clone ID: OTI8A9]
CF809993 100 µg

TSHZ1 Mouse Monoclonal Antibody [Clone ID: OTI8A9]

Sign In for Pricing
View Details
3,6-Di-O-(3,4,6-tri-O-acetyl-Beta-D-mannopyranosylethylidyne)-1,2-O-ethylidene-Beta-D-mannopyranose
TRC-D494390-5MG 5 mg

3,6-Di-O-(3,4,6-tri-O-acetyl-Beta-D-mannopyranosylethylidyne)-1,2-O-ethylidene-Beta-D-mannopyranose

Sign In for Pricing
View Details
Phospho-Bcl-2 (S70) Recombinant Rabbit monoclonal Antibody
HA751392 100 µL

Phospho-Bcl-2 (S70) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TTC19 (NM_017775) Human Recombinant Protein
TP311271L 1 mg

TTC19 (NM_017775) Human Recombinant Protein

Sign In for Pricing
View Details
UBTD1 Antibody
F40245-0.08ML 0.08 mL

UBTD1 Antibody

Sign In for Pricing
View Details
Kallikrein 6 (KLK6) Human Gene Knockout Kit (CRISPR)
KN402146 1 Kit

Kallikrein 6 (KLK6) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details