Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ycf49 (ycf49)

This Recombinant Uncharacterized protein ycf49 (ycf49) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Uncharacterized protein ycf49, ORF102

UniProt

P15811

Expression Region

1-102

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVLSYFTWFVHLSSVLEWLNIIYFFLLYTKLKKNLSLKTFIFSFFISFCSALCACTLHF FNNQSFYYFLINLQSFLTLFANITLYFSILIYKQQILKNQNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2S1, CT (CYP2S1, Cytochrome P450 2S1, CYPIIS1) (MaxLight 490)
MBS6290524-01 0.1 mL

CYP2S1, CT (CYP2S1, Cytochrome P450 2S1, CYPIIS1) (MaxLight 490)

Sign In for Pricing
View Details
CYP2S1, CT (CYP2S1, Cytochrome P450 2S1, CYPIIS1) (MaxLight 490)
MBS6290524-02 5x 0.1 mL

CYP2S1, CT (CYP2S1, Cytochrome P450 2S1, CYPIIS1) (MaxLight 490)

Sign In for Pricing
View Details
PCYT1B siRNA (Human)
MBS8202841-01 15 nmol

PCYT1B siRNA (Human)

Sign In for Pricing
View Details
PCYT1B siRNA (Human)
MBS8202841-02 30 nmol

PCYT1B siRNA (Human)

Sign In for Pricing
View Details
PCYT1B siRNA (Human)
MBS8202841-03 5x 30 nmol

PCYT1B siRNA (Human)

Sign In for Pricing
View Details
SCN3B (Sodium Channel Subunit Beta-3, Sodium Channel, Voltage-gated, Type III, beta Subunit)
491267 100 µL

SCN3B (Sodium Channel Subunit Beta-3, Sodium Channel, Voltage-gated, Type III, beta Subunit)

Sign In for Pricing
View Details