Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protein virB2 (virB2)

This Recombinant Agrobacterium tumefaciens Protein virB2 (virB2) spans the amino acid sequence from region 20-121.

Product Specifications

Product Name Alternative

Protein virB2

UniProt

P17792

Expression Region

20-121

Origin

Agrobacterium tumefaciens (strain C58 / ATCC 33970)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VMRMVSGYAPSVVGAMGWSIFSSGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGKTLTGGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPC5 (PE) discontinued
302631-PE 100 µL

PABPC5 (PE) discontinued

Sign In for Pricing
View Details
Fruit fly Stat92E Rabbit Polyclonal Antibody (Fluoro594)
orb3086287 200 µL

Fruit fly Stat92E Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
APOH Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2504415 100 µL

APOH Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
pT7-6×His-PSMB1 Plasmid
PVT60253 2 µg

pT7-6×His-PSMB1 Plasmid

Sign In for Pricing
View Details
RPS6KC1 AAV Vector (Rat) (CMV)
42601106 1 µg

RPS6KC1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
2-Methylisoquinoline-1,3 (2H,4H) -dione
EAA49453-01 0.5 g

2-Methylisoquinoline-1,3 (2H,4H) -dione

Sign In for Pricing
View Details