Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywcB (ywcB)

This Recombinant Bacillus subtilis Uncharacterized protein ywcB (ywcB) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Uncharacterized protein ywcB

UniProt

P39600

Expression Region

1-102

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSW AWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Zinc finger protein 512B, ZNF512B ELISA Kit
MBS9323494-01 48 Well

Human Zinc finger protein 512B, ZNF512B ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 512B, ZNF512B ELISA Kit
MBS9323494-02 96 Well

Human Zinc finger protein 512B, ZNF512B ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 512B, ZNF512B ELISA Kit
MBS9323494-03 5x 96 Well

Human Zinc finger protein 512B, ZNF512B ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 512B, ZNF512B ELISA Kit
MBS9323494-04 10x 96 Well

Human Zinc finger protein 512B, ZNF512B ELISA Kit

Sign In for Pricing
View Details
KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 490)
MBS6314684-01 0.1 mL

KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 490)

Sign In for Pricing
View Details
KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 490)
MBS6314684-02 5x 0.1 mL

KRT35, CT (KRT35, HHA5, HKA5, KRTHA5, Keratin, type I cuticular Ha5, Hair keratin, type I Ha5, Keratin-35) (MaxLight 490)

Sign In for Pricing
View Details