Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywcB (ywcB)

This Recombinant Bacillus subtilis Uncharacterized protein ywcB (ywcB) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Uncharacterized protein ywcB

UniProt

P39600

Expression Region

1-102

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSW AWLFAIAQFAMTWILSTVYSRRAAHFDKYVSALKEDLKGEQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 sigma/SFN/14 Rabbit Polyclonal Antibody (PE)
orb2613237 100 µg

14-3-3 sigma/SFN/14 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Polyclonal Antibody to CDX3
MBS669045-01 0.025 mg

Polyclonal Antibody to CDX3

Sign In for Pricing
View Details
Polyclonal Antibody to CDX3
MBS669045-02 0.1 mg

Polyclonal Antibody to CDX3

Sign In for Pricing
View Details
Polyclonal Antibody to CDX3
MBS669045-03 5x 0.1 mg

Polyclonal Antibody to CDX3

Sign In for Pricing
View Details
FABP1 Antibody
MBS8580570-01 0.1 mL

FABP1 Antibody

Sign In for Pricing
View Details
FABP1 Antibody
MBS8580570-02 0.1 mL (AF635)

FABP1 Antibody

Sign In for Pricing
View Details