Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tobacco yellow dwarf virus Movement protein (V2)

This Recombinant Tobacco yellow dwarf virus Movement protein (V2) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P31619

Expression Region

1-102

Origin

Tobacco yellow dwarf virus (strain Australia) (TYDV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYPAKYQVVPSGINYSDTPVGTFEQYQPQKAGESSEHFFSKVVVALIVILFAVGIVYLAY TLFLKDLILLLKAKKQKTTTEIGFGNTPLRRPGEGNPNGGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF555 conjugate, 0.1mg/mL
BNC550039-500 1x 500 µL

CD34 (ICO-115), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL
BNC680416-100 1x 100 µL

Fascin-1 (FSCN1/416), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (T200/797), CF647 conjugate, 0.1mg/mL
BNC470797-100 1x 100 µL

CD45RO (T200/797), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF740 conjugate, 0.1mg/mL
BNC740833-100 1x 100 µL

Calponin-1 (CALP + CNN1/832), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details