Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF103 (ORF103)

This Recombinant Acidianus bottle-shaped virus Uncharacterized protein ORF103 (ORF103) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF103

UniProt

A4ZUB5

Expression Region

1-103

Origin

Acidianus bottle-shaped virus (isolate Italy/Pozzuoli) (ABV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKYSSTLSYTLIVHTTSSTNCKEYLNYCKVTSMDPFVSMFQTFLEVLTATVLAFTAYEAY ERRMERQEKGEAMRDLIDLHRMRTIGDVIEKQEETKEKQAQGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL
BNC940676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-100 1x 100 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/1120), CF740 conjugate, 0.1mg/mL
BNC741120-100 1x 100 µL

Ep-CAM / CD326 (EGP40/1120), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL/597), CF640R conjugate, 0.1mg/mL
BNC400597-100 1x 100 µL

Alkaline Phosphatase (ALPL/597), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF488A conjugate, 0.1mg/mL
BNC881945-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1945), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details