Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

This Recombinant Sheep Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) spans the amino acid sequence from region 56-158.

Product Specifications

Product Name Alternative

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, CybS, CII-4, QPs3, Succinate dehydrogenase complex subunit D, Succinate-ubiquinone oxidoreductase cyto

UniProt

Q5G2C6

Expression Region

56-158

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSKAASLHWTGERVVSVLLLGLIPAAYLNPCSAMDYSLAATLTLHSHWGIGQVVTDYVH GDAVQKAAKTGLLVLSAFTFAGLCYFNYHDVGICKAVAMLWKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENOSF1 Rabbit Polyclonal Antibody
TA368242 100 µL

ENOSF1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LANPL (ANP32E) Human Gene Knockout Kit (CRISPR)
KN401677 1 Kit

LANPL (ANP32E) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (RFB4), CF488A conjugate, 0.1mg/mL
BNC881594-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (RFB4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cell Meter™ Mitochondrial Hydroxyl Radical Detection Kit *Red Fluorescence*
16055-AAT 200 Tests

Cell Meter™ Mitochondrial Hydroxyl Radical Detection Kit *Red Fluorescence*

Sign In for Pricing
View Details
M-MuLV Reverse Transcriptase (RNase H-), 10000U
ME2305 10000 U

M-MuLV Reverse Transcriptase (RNase H-), 10000U

Sign In for Pricing
View Details
FAS Antibody
KC-6088-01 50 μL

FAS Antibody

Sign In for Pricing
View Details