Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit B (mtrB)

This Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit B (mtrB) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit B, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

UniProt

Q58260

Expression Region

1-103

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATYVFIDQNIPLVYTVETGVITKGFGDLLFVDVSPIEEQIKKLETLVDAYEHSLDPRYP PLNSFPNRDGVYAISGYFKSAFFGFWIGLGIMALLAIILGVKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAGE1 Human shRNA Plasmid Kit (Locus ID 2543)
TL319577 1 Kit

GAGE1 Human shRNA Plasmid Kit (Locus ID 2543)

Sign In for Pricing
View Details
PE/iFluor® 750 Goat Anti-human IgG (H+L) Antibody *Cross Adsorbed*
50247-AAT 1 mg

PE/iFluor® 750 Goat Anti-human IgG (H+L) Antibody *Cross Adsorbed*

Sign In for Pricing
View Details
L3MBTL1 Antibody
A72391-100UL 100 µL

L3MBTL1 Antibody

Sign In for Pricing
View Details
SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (FITC)
251790-FITC 100 µL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (FITC)

Sign In for Pricing
View Details
Human Chemokine Like Factor Superfamily 5 ELISA Kit
MBS730220-01 48 Well

Human Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details
Human Chemokine Like Factor Superfamily 5 ELISA Kit
MBS730220-02 96 Well

Human Chemokine Like Factor Superfamily 5 ELISA Kit

Sign In for Pricing
View Details