Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0131 (MJ0131)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0131 (MJ0131) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0131

UniProt

Q57595

Expression Region

1-103

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGVIFWTIFIIQFMIWVFLSTTKIGRVIAFIWGTMPFLALYLKYTGYFPTIFENPDVNL FANLLSNFVVEWSYLVVQTTVPSWIGLLFGLKLSGNNDTPQII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]
TA500409AM 100 µL

STK3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details
Human ITGB1BP3 (NMRK2) activation kit by CRISPRa
GA109068 1 Kit

Human ITGB1BP3 (NMRK2) activation kit by CRISPRa

Sign In for Pricing
View Details
Goat IgG (H&L) Antibody ATTO 550 Conjugated Pre-Adsorbed
TA397637S 100 µg

Goat IgG (H&L) Antibody ATTO 550 Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS635864 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
C5ORF44 (TRAPPC13) Human Gene Knockout Kit (CRISPR)
KN418288 1 Kit

C5ORF44 (TRAPPC13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,3-Diphenyl-5,8-diaminopyrazino[2,3-d]pyridazine
TRC-D489500-250MG 250 mg

2,3-Diphenyl-5,8-diaminopyrazino[2,3-d]pyridazine

Sign In for Pricing
View Details