Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0131 (MJ0131)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0131 (MJ0131) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0131

UniProt

Q57595

Expression Region

1-103

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGVIFWTIFIIQFMIWVFLSTTKIGRVIAFIWGTMPFLALYLKYTGYFPTIFENPDVNL FANLLSNFVVEWSYLVVQTTVPSWIGLLFGLKLSGNNDTPQII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FTCD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C2]
TA504981BM 100 µL

FTCD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8C2]

Sign In for Pricing
View Details
POTEC Human Gene Knockout Kit (CRISPR)
KN427037 1 Kit

POTEC Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
6-epi-Obeticholic Acid-d7
TRC-O099102-50MG 50 mg

6-epi-Obeticholic Acid-d7

Sign In for Pricing
View Details
4-(4-Acetyl-3-hydroxy-2-propylphenoxy)butanoic Acid Ethyl Ester
TRC-A179140-250MG 250 mg

4-(4-Acetyl-3-hydroxy-2-propylphenoxy)butanoic Acid Ethyl Ester

Sign In for Pricing
View Details
MZT2B (NM_025029) Human Recombinant Protein
TP309713L 1 mg

MZT2B (NM_025029) Human Recombinant Protein

Sign In for Pricing
View Details
Coelenterazine F
#10114-2 1x 250 µg

Coelenterazine F

Sign In for Pricing
View Details