Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bartonella quintana Type IV secretion system protein virB3 (virB3)

This Recombinant Bartonella quintana Type IV secretion system protein virB3 (virB3) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Type IV secretion system protein virB3

UniProt

Q6FYW8

Expression Region

1-103

Origin

Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDTLFLACTRPATFAGVTMEGMALNVMATSILFILTSNFTMIGLGIGLHFVLREVTKY DHNQFRVLFAWLNTRGKQKNLTRWGGGSTSPLRLIRTYKELNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human IDH1 C-his8 protein, C-His Tag
MBS1560828-01 0.05 mg

Recombinant Human IDH1 C-his8 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human IDH1 C-his8 protein, C-His Tag
MBS1560828-02 0.1 mg

Recombinant Human IDH1 C-his8 protein, C-His Tag

Sign In for Pricing
View Details
Recombinant Human IDH1 C-his8 protein, C-His Tag
MBS1560828-03 5x 0.1 mg

Recombinant Human IDH1 C-his8 protein, C-His Tag

Sign In for Pricing
View Details
Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT
E2527Hu-01 48 Well

Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT

Sign In for Pricing
View Details
Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT
E2527Hu-02 96 Well

Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT

Sign In for Pricing
View Details
Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT
E2527Hu-03 5x 96 Tests

Human Phospholipase A2 Receptor 1, PLA2R1 ELISA KIT

Sign In for Pricing
View Details