Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalt transport protein CbiN (cbiN)

This Recombinant Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8XNY9

Expression Region

1-103

Origin

Clostridium perfringens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQIDENYEPWFSPLFEP ASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spata3 Mouse Gene Knockout Kit (CRISPR)
KN316552BN 1 Kit

Spata3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD2 Mouse Monoclonal Antibody [Clone ID: B-E2]
AM31181BT-N 1 mL (100 Tests)

CD2 Mouse Monoclonal Antibody [Clone ID: B-E2]

Sign In for Pricing
View Details
C17orf81 (ELP5) (NM_203414) Human Over-expression Lysate
LC404351 20 µg

C17orf81 (ELP5) (NM_203414) Human Over-expression Lysate

Sign In for Pricing
View Details
Anapc11 (NM_001038230) Mouse Tagged ORF Clone
MG200172 10 µg

Anapc11 (NM_001038230) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
N,N’,N’’,N’’’,N’’’’-Pentaacetylchitopentaose
TRC-P225000-10MG 10 mg

N,N’,N’’,N’’’,N’’’’-Pentaacetylchitopentaose

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL
BNC472302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details