Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalt transport protein CbiN (cbiN)

This Recombinant Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8XNY9

Expression Region

1-103

Origin

Clostridium perfringens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQIDENYEPWFSPLFEP ASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbca (NM_009321) Mouse Tagged ORF Clone
MG200394 10 µg

Tbca (NM_009321) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AATOM™ 610 azide
70253-AAT 1 mg

AATOM™ 610 azide

Sign In for Pricing
View Details
MDMX (MDM4) (NM_001278519) Human Tagged ORF Clone
RG237048 10 µg

MDMX (MDM4) (NM_001278519) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/837), CF647 conjugate, 0.1mg/mL
BNC470837-100 1x 100 µL

Ep-CAM / CD326 (EGP40/837), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNG2 Antibody
8C17810-AAT 50 µg

KCNG2 Antibody

Sign In for Pricing
View Details
ADAM23 Antibody
KC-3979-01 50 μL

ADAM23 Antibody

Sign In for Pricing
View Details