Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cobalt transport protein CbiN (cbiN)

This Recombinant Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-103.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8XNY9

Expression Region

1-103

Origin

Clostridium perfringens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNKRVLTNVILLLLVVFITIIPFFVAKNGEFGGSDDQAEEAITQIDENYEPWFSPLFEP ASGEIESLLFALQAAIGAGVIGFGLGYLKGKKKVNDEVNDKHR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bacterial Colony Counter BCLC-101
BCLC-101 1 Unit

Bacterial Colony Counter BCLC-101

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF488A conjugate, 0.1mg/mL
BNC880799-100 1x 100 µL

Cytokeratin 19 (KRT19/799), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DISP2 Human Gene Knockout Kit (CRISPR)
KN423141 1 Kit

DISP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B11]
TA504044BM 100 µL

TIMP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B11]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Cytokeratin,  30nm
GM-30-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Cytokeratin, 30nm

Sign In for Pricing
View Details
Human Gigaxonin (GAN) ELISA Kit
RD-GAN-Hu-01 96 Tests

Human Gigaxonin (GAN) ELISA Kit

Sign In for Pricing
View Details