Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd)

This Recombinant Mouse Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd) spans the amino acid sequence from region 57-159.

Product Specifications

Product Name Alternative

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, CybS, CII-4, QPs3, Succinate dehydrogenase complex subunit D, Succinate-ubiquinone oxidoreductase cyto

UniProt

Q9CXV1

Expression Region

57-159

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGLGQVVTDYVH GDTLPKAARAGLLALSALTFAGLCYFNYHDVGICRAVAMLWKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid
OR1005927-01 1 g

(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid

Sign In for Pricing
View Details
(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid
OR1005927-02 5 g

(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid

Sign In for Pricing
View Details
(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid
OR1005927-03 10 g

(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid

Sign In for Pricing
View Details
(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid
OR1005927-04 25 g

(S) -2- (2- (1H-Indol-3-yl) acetamido) -3-phenylpropanoic acid

Sign In for Pricing
View Details
SODD, NT (Silencer of Death Domain) (MaxLight 490) discontinued
S2000-30-ML490 100 µL

SODD, NT (Silencer of Death Domain) (MaxLight 490) discontinued

Sign In for Pricing
View Details
2-Chloro-5-nitrobenzaldehyde
TYD-00808-01 100 g

2-Chloro-5-nitrobenzaldehyde

Sign In for Pricing
View Details