Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Putative uncharacterized protein VPS65

UniProt

O13554

Expression Region

1-104

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQ SVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase A2 (PLA2G4A) Human Gene Knockout Kit (CRISPR)
KN220972BN 1 Kit

Phospholipase A2 (PLA2G4A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF740 conjugate, 0.1mg/mL
BNC742743-500 1x 500 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2743), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ECSIT (NM_001142465) Human Recombinant Protein
TP327595M 100 µg

ECSIT (NM_001142465) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR561127 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
APC Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122E-01 50 Tests

APC Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details
APC Anti-Mouse CD45.2 Antibody[104.2]
E-AB-F1122E-02 100 Tests

APC Anti-Mouse CD45.2 Antibody[104.2]

Sign In for Pricing
View Details