Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Putative uncharacterized protein VPS65

UniProt

O13554

Expression Region

1-104

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQ SVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1c (CD1C/1603), CF740 conjugate, 0.1mg/mL
BNC741603-500 1x 500 µL

CD1c (CD1C/1603), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CF®583R Tyramide
#96085 1x 500 µg

CF®583R Tyramide

Sign In for Pricing
View Details
1,1,1,3,8,10,10,10-Octachlorodecane
TRC-O185035-1MG 1 mg

1,1,1,3,8,10,10,10-Octachlorodecane

Sign In for Pricing
View Details
NAP1L1 (NM_004537) Human Recombinant Protein
TP320821 20 µg

NAP1L1 (NM_004537) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS801884 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
CYP7A1 (NM_000780) Human Over-expression Lysate
LC424522 20 µg

CYP7A1 (NM_000780) Human Over-expression Lysate

Sign In for Pricing
View Details