Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65)

This Recombinant Saccharomyces cerevisiae Putative uncharacterized protein VPS65 (VPS65) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Putative uncharacterized protein VPS65

UniProt

O13554

Expression Region

1-104

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQ SVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FastClick™ Digoxigenin (DIG) Azide
72800-AAT 1 mg

FastClick™ Digoxigenin (DIG) Azide

Sign In for Pricing
View Details
MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]
TA505734BM 100 µL

MDMX (MDM4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C9]

Sign In for Pricing
View Details
Human TTLL7 activation kit by CRISPRa
GA112591 1 Kit

Human TTLL7 activation kit by CRISPRa

Sign In for Pricing
View Details
Aggrecan Antibody
KC-20227-01 50 μL

Aggrecan Antibody

Sign In for Pricing
View Details
Aggrecan Antibody
KC-20227-02 100 µL

Aggrecan Antibody

Sign In for Pricing
View Details
Aggrecan Antibody
KC-20227-03 1 mL

Aggrecan Antibody

Sign In for Pricing
View Details