Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybcM (ybcM)

This Recombinant Bacillus subtilis Uncharacterized protein ybcM (ybcM) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Uncharacterized protein ybcM

UniProt

O31421

Expression Region

1-104

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVNTCIISLKGLDNADDR FVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-6843-3p Vector
mh42564 500 ng

LentimiRa-hsa-miR-6843-3p Vector

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)
MBS7013989-01 0.02 mg

Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)
MBS7013989-02 0.1 mg

Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details
Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)
MBS7013989-03 5x 0.1 mg

Recombinant Pseudoalteromonas haloplanktis Disulfide bond formation protein B (dsbB)

Sign In for Pricing
View Details
Recombinant Human Matrix Gla Protein
MBS144956-01 0.005 mg

Recombinant Human Matrix Gla Protein

Sign In for Pricing
View Details
Recombinant Human Matrix Gla Protein
MBS144956-02 0.02 mg

Recombinant Human Matrix Gla Protein

Sign In for Pricing
View Details