Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ybcM (ybcM)

This Recombinant Bacillus subtilis Uncharacterized protein ybcM (ybcM) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Uncharacterized protein ybcM

UniProt

O31421

Expression Region

1-104

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVNTCIISLKGLDNADDR FVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPEN ORF Vector (Human) (pORF)
ORF033254 1.0 µg DNA

SPEN ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
TMEM140 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2399705 3x 1.0 µg

TMEM140 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
3-Cyclopropyl-3- (methoxymethyl) azetidine
KHD02975-01 50 mg

3-Cyclopropyl-3- (methoxymethyl) azetidine

Sign In for Pricing
View Details
3-Cyclopropyl-3- (methoxymethyl) azetidine
KHD02975-02 0.5 g

3-Cyclopropyl-3- (methoxymethyl) azetidine

Sign In for Pricing
View Details
Vaccinia Virus Capping Enzyme
HBP000608 10 mL

Vaccinia Virus Capping Enzyme

Sign In for Pricing
View Details
Z-321
HY-19123-01 5 mg

Z-321

Sign In for Pricing
View Details