Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Type IV secretion system protein ptlB (ptlB)

This Recombinant Bordetella pertussis Type IV secretion system protein ptlB (ptlB) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlB, Pertussis toxin liberation protein B

UniProt

Q45391

Expression Region

1-104

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A1 (Melanoma Marker) (S100A1/1942), CF594 conjugate, 0.1mg/mL
BNC941942-100 1x 100 µL

S100A1 (Melanoma Marker) (S100A1/1942), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS648974 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Screen Quest™ Fluorimetric Neutrophil Elastase Inhibitor Screening Kit
11802-AAT 100 Tests

Screen Quest™ Fluorimetric Neutrophil Elastase Inhibitor Screening Kit

Sign In for Pricing
View Details
Human FTSJD1 (CMTR2) activation kit by CRISPRa
GA110965 1 Kit

Human FTSJD1 (CMTR2) activation kit by CRISPRa

Sign In for Pricing
View Details
MRGX4 Antibody
8G395-AAT 50 µg

MRGX4 Antibody

Sign In for Pricing
View Details
CCDC153 (NM_001033658) Human Over-expression Lysate
LY422411 100 µg

CCDC153 (NM_001033658) Human Over-expression Lysate

Sign In for Pricing
View Details