Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bordetella pertussis Type IV secretion system protein ptlB (ptlB)

This Recombinant Bordetella pertussis Type IV secretion system protein ptlB (ptlB) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Type IV secretion system protein ptlB, Pertussis toxin liberation protein B

UniProt

Q45391

Expression Region

1-104

Origin

Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adam15 activation kit by CRISPRa
GA200062 1 Kit

Mouse Adam15 activation kit by CRISPRa

Sign In for Pricing
View Details
Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF488A conjugate, 0.1mg/mL
BNC883014-100 1x 100 µL

Granzyme B (NK/T-Cell Lymphoma Marker) (GZMB/3014), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Recombinant Protein
TP325494 20 µg

Activin A Receptor Type IC (ACVR1C) (NM_001111033) Human Recombinant Protein

Sign In for Pricing
View Details
Cflar Mouse Gene Knockout Kit (CRISPR)
KN503218 1 Kit

Cflar Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Diaquo[(1R,2R)-1,2-cyclohexanediamine]platinum Dinitrate
TRC-D416760-10MG 10 mg

Diaquo[(1R,2R)-1,2-cyclohexanediamine]platinum Dinitrate

Sign In for Pricing
View Details
Recombinant Human CD40L/TNFSF5/CD40 Ligand (N-6His-Avi) Biotinylated
PKSH034016-01 20 µg

Recombinant Human CD40L/TNFSF5/CD40 Ligand (N-6His-Avi) Biotinylated

Sign In for Pricing
View Details