Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1219 (MJ1219)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1219 (MJ1219) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1219

UniProt

Q58616

Expression Region

1-104

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVNMAPNTNFASLVAVAGCVLLGYNYYTGNIFCGVIGSLLLFGALWSLNGGKIWGIISFI ISASIFCYINWDFILNLLFYSIIAFIVMSILILIFGNNRGGYYY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prion Protein (PrP, Prnp, ASCR, Atal Familial Insomnia, CD230 Antigen, CJD, Creutzfeld Jakob Disease, Gerstmann-Strausler-Scheinker Syndrome, GSS, Major Prion Protein, MGC26679, Prion Related Protein, PRIP, Prni, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc) (B
MBS6249256-01 0.1 mL

Prion Protein (PrP, Prnp, ASCR, Atal Familial Insomnia, CD230 Antigen, CJD, Creutzfeld Jakob Disease, Gerstmann-Strausler-Scheinker Syndrome, GSS, Major Prion Protein, MGC26679, Prion Related Protein, PRIP, Prni, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc) (B

Sign In for Pricing
View Details
Prion Protein (PrP, Prnp, ASCR, Atal Familial Insomnia, CD230 Antigen, CJD, Creutzfeld Jakob Disease, Gerstmann-Strausler-Scheinker Syndrome, GSS, Major Prion Protein, MGC26679, Prion Related Protein, PRIP, Prni, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc) (B
MBS6249256-02 5x 0.1 mL

Prion Protein (PrP, Prnp, ASCR, Atal Familial Insomnia, CD230 Antigen, CJD, Creutzfeld Jakob Disease, Gerstmann-Strausler-Scheinker Syndrome, GSS, Major Prion Protein, MGC26679, Prion Related Protein, PRIP, Prni, PrP27-30, PrP33-35C, PrPC, PrPSc, Sinc) (B

Sign In for Pricing
View Details
Complement C1q antibody
10R-C140A 0.05 mg

Complement C1q antibody

Sign In for Pricing
View Details
Rabbit Polyclonal GPR113 Antibody
NBP3-06237-50ul 50 µL

Rabbit Polyclonal GPR113 Antibody

Sign In for Pricing
View Details
RERE siRNA Oligos set (Human)
38820171 3x 5 nmol

RERE siRNA Oligos set (Human)

Sign In for Pricing
View Details
CCDC141, NT (CCDC141, Coiled-coil domain-containing protein 141) (MaxLight 490)
MBS6281536-01 0.1 mL

CCDC141, NT (CCDC141, Coiled-coil domain-containing protein 141) (MaxLight 490)

Sign In for Pricing
View Details