Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L891 (MIMI_L891)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L891 (MIMI_L891) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Uncharacterized protein L891

UniProt

Q5UQX9

Expression Region

1-104

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFKGFMINLFLTPIPDSPMNLLTIGTGIIGVIGGILVVKGFTFFDKCYNKNSTNNSNS DECLPIFIGGLLGGIIGIATGFSITIIIAITLAIKSIINCVESQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhgb4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3130605 3x 1.0 µg

Pcdhgb4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
PTGFR
551517 100 µg

PTGFR

Sign In for Pricing
View Details
PDX1 (NM_000209) Human Over-expression Lysate
LS003651 100 µg

PDX1 (NM_000209) Human Over-expression Lysate

Sign In for Pricing
View Details
PLC γ1 CRISPR Activation Plasmid (h)
sc-400472-ACT 20 µg

PLC γ1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Cobl ORF Vector (Rat) (pORF)
ORF065246 1.0 µg DNA

Cobl ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Ethyl 4-fluorophenylglyoxylate
275211-01 500 mg

Ethyl 4-fluorophenylglyoxylate

Sign In for Pricing
View Details