Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L891 (MIMI_L891)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L891 (MIMI_L891) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Uncharacterized protein L891

UniProt

Q5UQX9

Expression Region

1-104

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLFKGFMINLFLTPIPDSPMNLLTIGTGIIGVIGGILVVKGFTFFDKCYNKNSTNNSNS DECLPIFIGGLLGGIIGIATGFSITIIIAITLAIKSIINCVESQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raf1 Recombinant Protein (Human)
RP025675 100 µg

Raf1 Recombinant Protein (Human)

Sign In for Pricing
View Details
Recombinant Human Midkine Protein
NBP2-34997-100ug 100 µg

Recombinant Human Midkine Protein

Sign In for Pricing
View Details
1-Cyclopentyloxy-3- (trifluoromethyl) benzene
409592-01 100 mg

1-Cyclopentyloxy-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Cyclopentyloxy-3- (trifluoromethyl) benzene
409592-02 250 mg

1-Cyclopentyloxy-3- (trifluoromethyl) benzene

Sign In for Pricing
View Details
EBF2 Antibody, FITC conjugated
CSB-PA884503LC01HU-01 50 µg

EBF2 Antibody, FITC conjugated

Sign In for Pricing
View Details
EBF2 Antibody, FITC conjugated
CSB-PA884503LC01HU-02 100 µg

EBF2 Antibody, FITC conjugated

Sign In for Pricing
View Details