Recombinant Cryptococcus neoformans var. neoformans serotype D Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)
This Recombinant Cryptococcus neoformans var. neoformans serotype D Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) spans the amino acid sequence from region 1-104.
Product Specifications
Product Name Alternative
Vacuolar ATPase assembly integral membrane protein VMA21
UniProt
P0CS25
Expression Region
1-104
Origin
Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MSNRVSTGKMAMAPQESVQPAVLYKLVLFALLMAVVPIGTYFSTLNYLWDGASRCGFPSG LCSTTFAAISAIAAANLILVGYVVVAFREDAASRTGPLPEKKTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
