Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Vacuolar ATPase assembly integral membrane protein VMA21 (VMA21) spans the amino acid sequence from region 1-104.

Product Specifications

Product Name Alternative

Vacuolar ATPase assembly integral membrane protein VMA21

UniProt

P0CS24

Expression Region

1-104

Origin

Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNRVSTGKMAMAPQESVQPAVLYKLVLFALLMAVVPIGTYFSTLNYLWDGASRCGFPSG LCSTTFAAISAIAAANLILVGYVVVAFREDAASRTGPLPEKKTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MIF Antibody
NBP1-32192 100 µL

Rabbit Polyclonal MIF Antibody

Sign In for Pricing
View Details
AMPD2 Blocking Peptide
CBP3765-01 1 mg

AMPD2 Blocking Peptide

Sign In for Pricing
View Details
AMPD2 Blocking Peptide
CBP3765-02 5 mg

AMPD2 Blocking Peptide

Sign In for Pricing
View Details
High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)
abx409953-01 25 µg

High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)

Sign In for Pricing
View Details
High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)
abx409953-02 50 Tests

High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)

Sign In for Pricing
View Details
High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)
abx409953-03 100 Tests

High Affinity Immunoglobulin Gamma Fc Receptor I (FCGR1) Antibody (AF780)

Sign In for Pricing
View Details