Recombinant Helicobacter pylori ATP synthase subunit c (atpE)
This Recombinant Helicobacter pylori ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-105.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
P56087
Expression Region
1-105
Origin
Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKFLALFFLALVGVAFAHDGGMGGMDMIKSYSILGAMIGLGIAAFGGAIGMGNAAAATIT GTARNPGVGGKLLTTMFVAMAMIEAQVIYTLVFAIIAIYSNPFLS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740977-500 1x 500 µL
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040012-100 1x 100 µL
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041587-500 1x 500 µL
CD62L (L-Selectin) (LAM1-116), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941198-500 1x 500 µL
Cytokeratin 7 (KRT7/1198), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details