Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salinispora tropica NADH-quinone oxidoreductase subunit K (nuoK)

This Recombinant Salinispora tropica NADH-quinone oxidoreductase subunit K (nuoK) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit K, EC= 1.6.99.5, NADH dehydrogenase I subunit K, NDH-1 subunit K

UniProt

A4XC28

Expression Region

1-105

Origin

Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEFFSVEPNYYLVLAAVLFTIGAAGVLVRRNAIVLFMCVELMLNAANLTLVTFSRINGD LNGQIMAFFVMVVAAAEVVVGLAIIMAIYRTRRSASVDDANLLKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL
BNC470017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details