Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

This Recombinant Helicobacter pylori ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B6JN51

Expression Region

1-105

Origin

Helicobacter pylori (strain P12)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLALFFLALAGVAFAHDGGMGGMDMIKSYSILGAMIGLGIAAFGGAIGMGNAAAATIT GTARNPGVGGKLLTTMFVAMAMIEAQVIYTLVFAIIAIYSNPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Digital Display Ultrasonic Cleaner BULC-304
BULC-304 1 Unit

Digital Display Ultrasonic Cleaner BULC-304

Sign In for Pricing
View Details
RGS19 (NM_005873) Human Recombinant Protein
TP309082M 100 µg

RGS19 (NM_005873) Human Recombinant Protein

Sign In for Pricing
View Details
PPP6C (NM_001123355) Human Over-expression Lysate
LY426607 100 µg

PPP6C (NM_001123355) Human Over-expression Lysate

Sign In for Pricing
View Details
Syntaxin 3 (STX3) (NM_001178040) Human Over-expression Lysate
LC432811 20 µg

Syntaxin 3 (STX3) (NM_001178040) Human Over-expression Lysate

Sign In for Pricing
View Details
EnzyChrom™ Free Fatty Acid Assay Kit
EFFA-100 100 Tests

EnzyChrom™ Free Fatty Acid Assay Kit

Sign In for Pricing
View Details
AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI11F3]
CF810264 100 µg

AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI11F3]

Sign In for Pricing
View Details