Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

This Recombinant Helicobacter pylori ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

B6JN51

Expression Region

1-105

Origin

Helicobacter pylori (strain P12)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLALFFLALAGVAFAHDGGMGGMDMIKSYSILGAMIGLGIAAFGGAIGMGNAAAATIT GTARNPGVGGKLLTTMFVAMAMIEAQVIYTLVFAIIAIYSNPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-tert-Butylbenzyl Bromide
TRC-B692456-5G 5 g

4-tert-Butylbenzyl Bromide

Sign In for Pricing
View Details
Puberulic Acid
TRC-P196705-5MG 5 mg

Puberulic Acid

Sign In for Pricing
View Details
Tissue Total RNA, Endometriotic tissue
CR562098 5 µg

Tissue Total RNA, Endometriotic tissue

Sign In for Pricing
View Details
Medium Water Purification System BDPS-104
BDPS-104 1 Unit

Medium Water Purification System BDPS-104

Sign In for Pricing
View Details
Vitamin D Binding protein Recombinant Rabbit Monoclonal Antibody [JM10-36]
ET1703-09 100 µL

Vitamin D Binding protein Recombinant Rabbit Monoclonal Antibody [JM10-36]

Sign In for Pricing
View Details
Human METTL25B activation kit by CRISPRa
GA109557 1 Kit

Human METTL25B activation kit by CRISPRa

Sign In for Pricing
View Details