Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1457 (AF_1457)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1457 (AF_1457) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1457

UniProt

O28815

Expression Region

1-105

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDARDIVLSVISVFSAAALVYRWLSLYDRVDMTVIFFATLLIASLTLLLISIELRMQRIM DEFKSVKRTIAVNSDDLEGRIERLFIEKVRDLEDKLESIERRMYR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MFSD5 (NM_032889) Human Over-expression Lysate
LY403205 100 µg

MFSD5 (NM_032889) Human Over-expression Lysate

Sign In for Pricing
View Details
p-MDM2 Antibody (pT218)
F48546-0.4ML 0.4 mL

p-MDM2 Antibody (pT218)

Sign In for Pricing
View Details
Mouse Pus1 activation kit by CRISPRa
GA205922 1 Kit

Mouse Pus1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Tiam2 activation kit by CRISPRa
GA204858 1 Kit

Mouse Tiam2 activation kit by CRISPRa

Sign In for Pricing
View Details
Total Phenols Colorimetric Assay Kit (Plant samples)
E-BC-K354-M-01 96 T (40 samples)

Total Phenols Colorimetric Assay Kit (Plant samples)

Sign In for Pricing
View Details
Total Phenols Colorimetric Assay Kit (Plant samples)
E-BC-K354-M-02 500 Assays (242 samples)

Total Phenols Colorimetric Assay Kit (Plant samples)

Sign In for Pricing
View Details