Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706)

This Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein MTH_1706

UniProt

O27741

Expression Region

1-105

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTL PALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Fam135b Pre-designed siRNA Set B
SI204748B 1 Each

Rat Fam135b Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Monoclonal SerpinB2 Antibody (930109) [Janelia Fluor 549]
FAB8550I 0.1 mL

Mouse Monoclonal SerpinB2 Antibody (930109) [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse NudC domain-containing protein 2, Nudcd2 ELISA KIT
ELI-22428m 96 Tests

Mouse NudC domain-containing protein 2, Nudcd2 ELISA KIT

Sign In for Pricing
View Details
Rabbit anti-Shigella flexneri HNS Polyclonal Antibody
MBS7162454 Inquire

Rabbit anti-Shigella flexneri HNS Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cul1 shRNA (UAS) - Lentiviral mouse Cul1 shRNA (UAS, GFP) plasmid
GTR15103546 1 Vial

Lentiviral mouse Cul1 shRNA (UAS) - Lentiviral mouse Cul1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
5HT (Serotonin) 5A Receptor, 5HT5A R Antibody
orb176268 100 µL

5HT (Serotonin) 5A Receptor, 5HT5A R Antibody

Sign In for Pricing
View Details