Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706)

This Recombinant Methanothermobacter thermautotrophicus Uncharacterized protein MTH_1706 (MTH_1706) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein MTH_1706

UniProt

O27741

Expression Region

1-105

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNARDKKFMTAGIIIALIIAVLAPFLASPNPDGLESTAEKVMPNPETEPVLESPLPDYTL PALGDSPFGGVVSMVIGTILVLAIAYGVGAVFRGRKAAGEEGGEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Procollagen Type III N Terminal Propeptide ELISA Kit
GTR10322261 96 Well

Monkey Procollagen Type III N Terminal Propeptide ELISA Kit

Sign In for Pricing
View Details
PTP4A3 Human Over-expression Lysate
orb1347323 100 µg

PTP4A3 Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse IFN-α-Ab ELISA Kit
EMI0048 96 Tests

Mouse IFN-α-Ab ELISA Kit

Sign In for Pricing
View Details
Dulbecco's Phosphate Buffer (DPBS), with calcium, magnesium, sodium pyruvate, glucose, without phenol red
MBS2564389-01 500 mL

Dulbecco's Phosphate Buffer (DPBS), with calcium, magnesium, sodium pyruvate, glucose, without phenol red

Sign In for Pricing
View Details
Dulbecco's Phosphate Buffer (DPBS), with calcium, magnesium, sodium pyruvate, glucose, without phenol red
MBS2564389-02 5x 500 mL

Dulbecco's Phosphate Buffer (DPBS), with calcium, magnesium, sodium pyruvate, glucose, without phenol red

Sign In for Pricing
View Details
Human Keratin 4 ELISA Kit
SL2294Hu-01 48 Tests

Human Keratin 4 ELISA Kit

Sign In for Pricing
View Details