Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ylaH

UniProt

O07632

Expression Region

1-105

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDVSERLSFFAALYQVDRQPAAGMWLLYGTIFVLAVIVFKLGFAKRLPVLKSAVVYVFL ALGCTVLTFLGVFLPVAEGLVVAALILIIYKIRLYQSKKGQSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ghrelin (GHRL) Sheep ELISA Kit
D6813 96 Tests

Ghrelin (GHRL) Sheep ELISA Kit

Sign In for Pricing
View Details
AMOTL1 Rabbit Polyclonal Antibody (FITC)
orb2121471 100 µL

AMOTL1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse IL-1ra/IL-1F3 Recombinant Protein
PROTP25085-10ug 10 µg

Mouse IL-1ra/IL-1F3 Recombinant Protein

Sign In for Pricing
View Details
Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)
FY-AB41602-01 1 mL

Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)
FY-AB41602-02 100 µL

Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details
Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)
FY-AB41602-03 200 µL

Biotin-Linked Anti-Ferritin, Light Polypeptide (FTL)

Sign In for Pricing
View Details