Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ylaH (ylaH) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ylaH

UniProt

O07632

Expression Region

1-105

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDVSERLSFFAALYQVDRQPAAGMWLLYGTIFVLAVIVFKLGFAKRLPVLKSAVVYVFL ALGCTVLTFLGVFLPVAEGLVVAALILIIYKIRLYQSKKGQSAKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C21orf122 sgRNA CRISPR Lentivector (Human) (Target 3)
K0344104 1.0 µg DNA

C21orf122 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
5,6-Dichloro-2,4-Pyrimidinediamine
TRC-D437380-2.5G 2.5 g

5,6-Dichloro-2,4-Pyrimidinediamine

Sign In for Pricing
View Details
Bial's Reagent (Sumner)
41000500 500 mL

Bial's Reagent (Sumner)

Sign In for Pricing
View Details
Iniparib (BSI-201)
S1087-50mg 50 mg

Iniparib (BSI-201)

Sign In for Pricing
View Details
Recombinant Human Anthrax Toxin Receptor 1/ANTXR1/TEM8 (C-6His)
CA34-1mg 1 mg

Recombinant Human Anthrax Toxin Receptor 1/ANTXR1/TEM8 (C-6His)

Sign In for Pricing
View Details
Tropisetron HCl
C08125-10mg 10 mg

Tropisetron HCl

Sign In for Pricing
View Details