Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable signal peptidase complex subunit 1 (C34B2.10)

This Recombinant Probable signal peptidase complex subunit 1 (C34B2.10) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Probable signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

O44953

Expression Region

1-105

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGMIAMLPAPLQKLSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVL GASAFTALIILPPWPFLFRKNPIVWHTPAEPQESGDKKKETKKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dpf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
18531116 3x 1.0 µg

Dpf3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CDX4 (Caudal Type Homeobox 4) (MaxLight 650)
244580-ML650 100 µL

CDX4 (Caudal Type Homeobox 4) (MaxLight 650)

Sign In for Pricing
View Details
HnRNP G-T (1B14) Rabbit Monoclonal Antibody
E28G2540 100 µL

HnRNP G-T (1B14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FLT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]
TA806805AM 100 µL

FLT4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G2]

Sign In for Pricing
View Details
Brilliant Violet 605™ anti-mouse CD117 (c-kit)
GT03921 500 µL

Brilliant Violet 605™ anti-mouse CD117 (c-kit)

Sign In for Pricing
View Details
ECM1 (Extracellular Matrix Protein 1)
479867 100 µL

ECM1 (Extracellular Matrix Protein 1)

Sign In for Pricing
View Details