Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable signal peptidase complex subunit 1 (C34B2.10)

This Recombinant Probable signal peptidase complex subunit 1 (C34B2.10) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Probable signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

O44953

Expression Region

1-105

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGMIAMLPAPLQKLSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVL GASAFTALIILPPWPFLFRKNPIVWHTPAEPQESGDKKKETKKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human DDA1 Polyclonal Antibody
PHK73701 100 μg

Anti-Human DDA1 Polyclonal Antibody

Sign In for Pricing
View Details
Lonicerae Flos Extract
C02873-5mg 5 mg

Lonicerae Flos Extract

Sign In for Pricing
View Details
Cebpd (NM_013154) Rat Untagged Clone
RN201147 10 µg

Cebpd (NM_013154) Rat Untagged Clone

Sign In for Pricing
View Details
Boiling Water Bath, Double Wall, Rectangular, Multiple Place
2051960/2 1 Each

Boiling Water Bath, Double Wall, Rectangular, Multiple Place

Sign In for Pricing
View Details
GLOD4 shRNA Plasmid (m)
sc-145426-SH 20 µg

GLOD4 shRNA Plasmid (m)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS500993 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details