Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable signal peptidase complex subunit 1 (C34B2.10)

This Recombinant Probable signal peptidase complex subunit 1 (C34B2.10) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Probable signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

O44953

Expression Region

1-105

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDGMIAMLPAPLQKLSSHIDFQGQKVAERTYQVILTIAGIIGFLVGFWTQQLSYAMFTVL GASAFTALIILPPWPFLFRKNPIVWHTPAEPQESGDKKKETKKTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Pyridinecarbonitrile
sc-223665B 500 g

4-Pyridinecarbonitrile

Sign In for Pricing
View Details
Mouse Ghitm qPCR Primer Pair
QM31098S 200 Tests

Mouse Ghitm qPCR Primer Pair

Sign In for Pricing
View Details
Recombinant Human VEGF-C Protein, GST, E.coli-100ug
QP8577-ec-100ug 100ug

Recombinant Human VEGF-C Protein, GST, E.coli-100ug

Sign In for Pricing
View Details
Rat Defb30 Pre-designed siRNA Set A
SI203694A 1 Each

Rat Defb30 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RANBP6 (NM_012416) Human Tagged ORF Clone Lentiviral Particle
RC210538L4V 200 µL

RANBP6 (NM_012416) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PE Rabbit anti-Mouse LAMP1/CD107a mAb
A26061-01 50 Tests

PE Rabbit anti-Mouse LAMP1/CD107a mAb

Sign In for Pricing
View Details