Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori ATP synthase subunit c (atpE)

This Recombinant Helicobacter pylori ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q1CS52

Expression Region

1-105

Origin

Helicobacter pylori (strain HPAG1)

Field of Research

Infectious Disease & Virology; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFLALFFLALAGVAFAHDGGMGGMDMIKSYSILGAMIGLGIAAFGGAIGMGNAAAATIT GTARNPGVGGKLLTTMFVAMAMIEAQVIYTLVFAIIAIYSNPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R2B Polyclonal Antibody
E-AB-90187-01 60 µL

PPP2R2B Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R2B Polyclonal Antibody
E-AB-90187-02 120 µL

PPP2R2B Polyclonal Antibody

Sign In for Pricing
View Details
PPP2R2B Polyclonal Antibody
E-AB-90187-03 200 µL

PPP2R2B Polyclonal Antibody

Sign In for Pricing
View Details
HNRPH2 (HNRNPH2) (NM_001032393) Human Over-expression Lysate
LC422325 20 µg

HNRPH2 (HNRNPH2) (NM_001032393) Human Over-expression Lysate

Sign In for Pricing
View Details
Lanicemine-d5
TRC-L173952-1MG 1 mg

Lanicemine-d5

Sign In for Pricing
View Details
Isoxazolo[5,4-b]pyridin-3-amine
TRC-I918125-250MG 250 mg

Isoxazolo[5,4-b]pyridin-3-amine

Sign In for Pricing
View Details