Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Bovine Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q3T0E3

Expression Region

2-106

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATPGPGDPVDAKSGKAPLAQRIDPTREKLTPAQLQFMRQAQLAQWQKTLPQRRTRNIVTG LGIGALVLAIYGYTFYSVSQERFLDELEDEAKAARARALERASGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse LDLR protein (His tag)
PDEM100262-01 20 µg

Recombinant Mouse LDLR protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse LDLR protein (His tag)
PDEM100262-02 100 µg

Recombinant Mouse LDLR protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse LDLR protein (His tag)
PDEM100262-03 500 µg

Recombinant Mouse LDLR protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse LDLR protein (His tag)
PDEM100262-04 1 mg

Recombinant Mouse LDLR protein (His tag)

Sign In for Pricing
View Details
Human Cluster Of Differentiation 72 (CD72) ELISA Kit
RD-CD72-Hu-01 96 Tests

Human Cluster Of Differentiation 72 (CD72) ELISA Kit

Sign In for Pricing
View Details
Human Cluster Of Differentiation 72 (CD72) ELISA Kit
RD-CD72-Hu-02 48 Tests

Human Cluster Of Differentiation 72 (CD72) ELISA Kit

Sign In for Pricing
View Details