Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Bovine Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q3T0E3

Expression Region

2-106

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATPGPGDPVDAKSGKAPLAQRIDPTREKLTPAQLQFMRQAQLAQWQKTLPQRRTRNIVTG LGIGALVLAIYGYTFYSVSQERFLDELEDEAKAARARALERASGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate
LY400060 100 µg

Gastric Inhibitory Polypeptide Receptor (GIPR) (NM_000164) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707819 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mini Sample Human GzmB (Granzyme B) ELISA Kit
E-MSEL-H0019-01 24 Tests

Mini Sample Human GzmB (Granzyme B) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human GzmB (Granzyme B) ELISA Kit
E-MSEL-H0019-02 48 Tests

Mini Sample Human GzmB (Granzyme B) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Human GzmB (Granzyme B) ELISA Kit
E-MSEL-H0019-03 96 Tests

Mini Sample Human GzmB (Granzyme B) ELISA Kit

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL
BNC041564-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1564R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details