Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1590

UniProt

Q58985

Expression Region

1-105

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRISPLIAGLIGGFTAAILQALFKVFPPPAYGICIACHTRDLVNWIINHLFGTTLGMALV SKAFPVLTVVGIFIGALITTFIYKETELKQTHSPVYWFHIRNFSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC286960 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7486006 1.0 µg DNA

LOC286960 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Pigeon Probable G-Protein Coupled Receptor 173 (GPR173) ELISA Kit
MBS9942824 Inquire

Pigeon Probable G-Protein Coupled Receptor 173 (GPR173) ELISA Kit

Sign In for Pricing
View Details
Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit
MBS9938031-01 48 Well

Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit

Sign In for Pricing
View Details
Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit
MBS9938031-02 96 Well

Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit

Sign In for Pricing
View Details
Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit
MBS9938031-03 5x 96 Well

Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit

Sign In for Pricing
View Details
Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit
MBS9938031-04 10x 96 Well

Bovine 3',5'-Bisphosphate Nucleotidase 1 (BPNT1) ELISA Kit

Sign In for Pricing
View Details