Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein L416

UniProt

Q5UQL5

Expression Region

1-105

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYTSIYQNSYVVFIISLIVLLIIFYVFKIGYSTVVVNGKVEKRFNWKYPLAISLVIWVIW YFLLYPPSDVNINSSKQVGGTETSTIGDIVGSGVRQQKINMDNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fruit fly DLG Antibody-iFluor647 Conjugate
DZ01287-iFluor647 200 µL

Anti-Fruit fly DLG Antibody-iFluor647 Conjugate

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL
BNC682990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62451R-BF405-01 20 µL

GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-62451R-BF405-02 100 µL

GTF2I Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
6- (2-Chloro-6-fluorobenzoyl) -2,3-dihydro-1,4-benzodioxine
WTB97121-01 100 mg

6- (2-Chloro-6-fluorobenzoyl) -2,3-dihydro-1,4-benzodioxine

Sign In for Pricing
View Details
6- (2-Chloro-6-fluorobenzoyl) -2,3-dihydro-1,4-benzodioxine
WTB97121-02 1 g

6- (2-Chloro-6-fluorobenzoyl) -2,3-dihydro-1,4-benzodioxine

Sign In for Pricing
View Details