Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein L416

UniProt

Q5UQL5

Expression Region

1-105

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYTSIYQNSYVVFIISLIVLLIIFYVFKIGYSTVVVNGKVEKRFNWKYPLAISLVIWVIW YFLLYPPSDVNINSSKQVGGTETSTIGDIVGSGVRQQKINMDNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXT-2 siRNA (h)
sc-91277 10 µM

NXT-2 siRNA (h)

Sign In for Pricing
View Details
Lentiviral mouse Isoc1 shRNA (UAS) - Lentiviral mouse Isoc1 shRNA (UAS, iRFP) (100)
GTR15223071 1 Vial

Lentiviral mouse Isoc1 shRNA (UAS) - Lentiviral mouse Isoc1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
RORα CRISPR Activation Plasmid (h)
sc-400578-ACT 20 µg

RORα CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
PC2 (E-8) AC
sc-374140 AC 500 µg/mL - 25% ag

PC2 (E-8) AC

Sign In for Pricing
View Details
3-Fluoro-2-nitrobenzoic acid ethyl ester
FF66845-01 5 g

3-Fluoro-2-nitrobenzoic acid ethyl ester

Sign In for Pricing
View Details
3-Fluoro-2-nitrobenzoic acid ethyl ester
FF66845-02 10 g

3-Fluoro-2-nitrobenzoic acid ethyl ester

Sign In for Pricing
View Details