Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L416 (MIMI_L416) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein L416

UniProt

Q5UQL5

Expression Region

1-105

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYTSIYQNSYVVFIISLIVLLIIFYVFKIGYSTVVVNGKVEKRFNWKYPLAISLVIWVIW YFLLYPPSDVNINSSKQVGGTETSTIGDIVGSGVRQQKINMDNWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APRT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV682925 1.0 µg DNA

APRT Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
ELMOD2 (ELMO Domain-Containing Protein 2, ELMO/CED-12 Domain Containing 2)
480133 100 µL

ELMOD2 (ELMO Domain-Containing Protein 2, ELMO/CED-12 Domain Containing 2)

Sign In for Pricing
View Details
CD1B (NM_001764) Human Recombinant Protein
TP319131M 100 µg

CD1B (NM_001764) Human Recombinant Protein

Sign In for Pricing
View Details
KCNK3 (NM_002246) Human Recombinant Protein
TP762252 50 µg

KCNK3 (NM_002246) Human Recombinant Protein

Sign In for Pricing
View Details
ST6GALNAC5 Peptide
orb2014463 100 µg

ST6GALNAC5 Peptide

Sign In for Pricing
View Details
PLB (phospho Ser16/T17) Polyclonal Antibody
UB-GEN-2378 100 µL

PLB (phospho Ser16/T17) Polyclonal Antibody

Sign In for Pricing
View Details