Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q5R7J0

Expression Region

2-106

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSGSGDPLDSKRGEAPFAQRIDPTREKLTPEQLHFMRQAQLAQWQKVLPRRRTRNIVTG LGIGALVLAIHGYTFYSISQERFLDELEDEAKAARARALARASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thallos Gold AM - gold fluorescent thallium indicator
1391C 500 µg

Thallos Gold AM - gold fluorescent thallium indicator

Sign In for Pricing
View Details
(1R,2R,3S)-Ticagrelor
TRC-T437685-10MG 10 mg

(1R,2R,3S)-Ticagrelor

Sign In for Pricing
View Details
N-Propionylglycine-2,2-d2
TRC-P788501-5MG 5 mg

N-Propionylglycine-2,2-d2

Sign In for Pricing
View Details
Single Beam UV Visible Spectrophotometer BSSUV-304
BSSUV-304 Each

Single Beam UV Visible Spectrophotometer BSSUV-304

Sign In for Pricing
View Details
5-Carboxy-X-Rhodamine-PEO8-propionate, Succinimidyl Ester (5-ROX-PEO8 SE)
#90089 1x 1 mg

5-Carboxy-X-Rhodamine-PEO8-propionate, Succinimidyl Ester (5-ROX-PEO8 SE)

Sign In for Pricing
View Details
Coelenterazine Sampler Kit
#10123 1 Kit

Coelenterazine Sampler Kit

Sign In for Pricing
View Details