Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q5R7J0

Expression Region

2-106

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSGSGDPLDSKRGEAPFAQRIDPTREKLTPEQLHFMRQAQLAQWQKVLPRRRTRNIVTG LGIGALVLAIHGYTFYSISQERFLDELEDEAKAARARALARASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSF2 Mouse Monoclonal Antibody [Clone ID: OTI4G9]
CF807406 100 µg

HSF2 Mouse Monoclonal Antibody [Clone ID: OTI4G9]

Sign In for Pricing
View Details
Ethyl 3-oxo-2-Phenylpropanoate (>90%)
TRC-B441355-10MG 10 mg

Ethyl 3-oxo-2-Phenylpropanoate (>90%)

Sign In for Pricing
View Details
PSMD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]
TA503229BM 100 µL

PSMD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details
Vitamin K2(5)
TRC-V676120-5MG 5 mg

Vitamin K2(5)

Sign In for Pricing
View Details
EEF1D (NM_001130053) Human Over-expression Lysate
LY427131 100 µg

EEF1D (NM_001130053) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562517 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details