Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56)

This Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56) spans the amino acid sequence from region 2-106.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 56

UniProt

Q5R7J0

Expression Region

2-106

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSGSGDPLDSKRGEAPFAQRIDPTREKLTPEQLHFMRQAQLAQWQKVLPRRRTRNIVTG LGIGALVLAIHGYTFYSISQERFLDELEDEAKAARARALARASGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Indo-1, pentapotassium salt *CAS 132319-56-3*
21040-AAT 1 mg

Indo-1, pentapotassium salt *CAS 132319-56-3*

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF740 conjugate, 0.1mg/mL
BNC742013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCFD1 Rabbit Polyclonal Antibody
TA381275 100 µL

SCFD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Collagen XVII (COL17A1) (NM_000494) Human Over-expression Lysate
LC424682 20 µg

Collagen XVII (COL17A1) (NM_000494) Human Over-expression Lysate

Sign In for Pricing
View Details
ErbB 3 (ERBB3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]
TA803828AM 100 µL

ErbB 3 (ERBB3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A5]

Sign In for Pricing
View Details
Human GGCT activation kit by CRISPRa
GA112312 1 Kit

Human GGCT activation kit by CRISPRa

Sign In for Pricing
View Details